SCOPe 2.07: Domain d7accj_: 7acc J:

Lineage for d7accj_ (7acc J:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165

4. Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family)
   automatically mapped to Pfam PF06399

5. Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins)

6. Protein automated matches [394245] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [394246] (3 PDB entries)

8. Domain d7accj_: 7acc J: [394318]
   Other proteins in same PDB: d7accc2, d7acce2, d7accg2, d7acch2
   automated match to d1wplk_
   complexed with k

Details for d7accj_

PDB Entry: 7acc, 2.04 Å

PDB Description: human gtp cyclohydrolase i feedback regulatory protein (gfrp)

PDB Compounds: (J:) GTP cyclohydrolase 1 feedback regulatory protein

SCOPe Domain Sequences for d7accj_:

Sequence; same for both SEQRES and ATOM records:

>d7accj_ d.205.1.1 (J:) automated matches {Homo sapiens [TaxId: 9606]}
pyllistqirmevgptmvgdeqsdpelmqhlgaskrralgnnfyeyyvddpprivldkle
rrgfrvlsmtgvgqtlvwclhke

Timeline for d7accj_:

• d7accj_ is new in SCOPe 2.07-stable
  
• d7accj_ appears in the current release, SCOPe 2.08