Lineage for d1cjta_ (1cjt A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207098Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1207099Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 1207127Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)
  7. 1207128Species Dog (Canis familiaris) [TaxId:9615] [55078] (11 PDB entries)
    Uniprot P30803 458-646
  8. 1207132Domain d1cjta_: 1cjt A: [39419]
    Other proteins in same PDB: d1cjtb_, d1cjtc1, d1cjtc2
    complexed with cl, dad, fok, gsp, mes, mg, mn

Details for d1cjta_

PDB Entry: 1cjt (more details), 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mn, and mg
PDB Compounds: (A:) adenylate cyclase, type v

SCOPe Domain Sequences for d1cjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjta_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

SCOPe Domain Coordinates for d1cjta_:

Click to download the PDB-style file with coordinates for d1cjta_.
(The format of our PDB-style files is described here.)

Timeline for d1cjta_: