SCOPe 2.05: Domain d1cs4a_: 1cs4 A:

Lineage for d1cs4a_ (1cs4 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries)
   Uniprot P30803 458-646

8. Domain d1cs4a_: 1cs4 A: [39418]
   Other proteins in same PDB: d1cs4b_, d1cs4c1, d1cs4c2
   complexed with 101, cl, fok, gsp, mes, mg, pop

Details for d1cs4a_

PDB Entry: 1cs4, 2.5 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg

PDB Compounds: (A:) type v adenylate cyclase

SCOPe Domain Sequences for d1cs4a_:

Sequence; same for both SEQRES and ATOM records:

>d1cs4a_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

Timeline for d1cs4a_:

• d1cs4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cs4a_ appears in SCOPe 2.04
  
• d1cs4a_ appears in SCOPe 2.06
  
• d1cs4a_ appears in the current release, SCOPe 2.08