Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [226712] (3 PDB entries) |
Domain d6zn3k_: 6zn3 K: [394081] automated match to d5tp5a_ |
PDB Entry: 6zn3 (more details), 2.51 Å
SCOPe Domain Sequences for d6zn3k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zn3k_ a.39.1.0 (K:) automated matches {Plasmodium falciparum [TaxId: 36329]} vadiqqleekvdesdvriyfnekssggkisidnasynarklglapssidekkikelygdn ltyeqyleylsicvhdkdnveelikmfahfdnnctgyltksqmknilttwgdaltdqeai dalnafssednidyklfcedilq
Timeline for d6zn3k_:
View in 3D Domains from other chains: (mouse over for more information) d6zn3b_, d6zn3e_, d6zn3h_, d6zn3n_ |