SCOPe 2.07: Domain d6z1fh1: 6z1f H:13-150

Lineage for d6z1fh1 (6z1f H:13-150)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [385346] (2 PDB entries)

8. Domain d6z1fh1: 6z1f H:13-150 [393792]
   Other proteins in same PDB: d6z1fa2, d6z1fb2, d6z1fc2, d6z1fd2, d6z1fe2, d6z1ff2, d6z1fg2, d6z1fh2, d6z1fi_, d6z1fj_, d6z1fk_, d6z1fl_, d6z1fm_, d6z1fn_, d6z1fo_, d6z1fp_
   automated match to d1ir2u2
   complexed with adp, ags, cap, mg

Details for d6z1fh1

PDB Entry: 6z1f, 2.86 Å

PDB Description: cryoem structure of rubisco activase with its substrate rubisco from nostoc sp. (strain pcc7120)

PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6z1fh1:

Sequence; same for both SEQRES and ATOM records:

>d6z1fh1 d.58.9.0 (H:13-150) automated matches {Nostoc sp. [TaxId: 103690]}
gykagvqdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt
dlltdldrykgrcydiepvpgednqfiayiaypldlfeegsitnvltsivgnvfgfkalr
alrledirfpvayiktfq

Timeline for d6z1fh1:

• d6z1fh1 is new in SCOPe 2.07-stable
  
• d6z1fh1 appears in the current release, SCOPe 2.08