SCOPe 2.07: Domain d6z1ff2: 6z1f F:151-476

Lineage for d6z1ff2 (6z1f F:151-476)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (16 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [385348] (2 PDB entries)

8. Domain d6z1ff2: 6z1f F:151-476 [393790]
   Other proteins in same PDB: d6z1fa1, d6z1fb1, d6z1fc1, d6z1fd1, d6z1fe1, d6z1ff1, d6z1fg1, d6z1fh1, d6z1fi_, d6z1fj_, d6z1fk_, d6z1fl_, d6z1fm_, d6z1fn_, d6z1fo_, d6z1fp_
   automated match to d1ir2a1
   complexed with adp, ags, cap, mg

Details for d6z1ff2

PDB Entry: 6z1f, 2.86 Å

PDB Description: cryoem structure of rubisco activase with its substrate rubisco from nostoc sp. (strain pcc7120)

PDB Compounds: (F:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6z1ff2:

Sequence; same for both SEQRES and ATOM records:

>d6z1ff2 c.1.14.1 (F:151-476) automated matches {Nostoc sp. [TaxId: 103690]}
gpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsa
pfqrwrdrflfvadaitkaqaetgeikghylnvtaptceemlkraeyakelkqpiimhdy
ltagftanttlarwcrdngvllhihramhavidrqknhgihfrvlakalrlsggdhihtg
tvvgklegergitmgfvdllrenyveqdksrgiyftqdwaslpgvmavasggihvwhmpa
lveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrnlaregndvireaa
kwspelavacelwkeikfefeamdtv

Timeline for d6z1ff2:

• d6z1ff2 is new in SCOPe 2.07-stable
  
• d6z1ff2 appears in the current release, SCOPe 2.08