Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein automated matches [226984] (16 species) not a true protein |
Species Nostoc sp. [TaxId:103690] [385348] (2 PDB entries) |
Domain d6z1ff2: 6z1f F:151-476 [393790] Other proteins in same PDB: d6z1fa1, d6z1fb1, d6z1fc1, d6z1fd1, d6z1fe1, d6z1ff1, d6z1fg1, d6z1fh1, d6z1fi_, d6z1fj_, d6z1fk_, d6z1fl_, d6z1fm_, d6z1fn_, d6z1fo_, d6z1fp_ automated match to d1ir2a1 complexed with adp, ags, cap, mg |
PDB Entry: 6z1f (more details), 2.86 Å
SCOPe Domain Sequences for d6z1ff2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z1ff2 c.1.14.1 (F:151-476) automated matches {Nostoc sp. [TaxId: 103690]} gpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsa pfqrwrdrflfvadaitkaqaetgeikghylnvtaptceemlkraeyakelkqpiimhdy ltagftanttlarwcrdngvllhihramhavidrqknhgihfrvlakalrlsggdhihtg tvvgklegergitmgfvdllrenyveqdksrgiyftqdwaslpgvmavasggihvwhmpa lveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrnlaregndvireaa kwspelavacelwkeikfefeamdtv
Timeline for d6z1ff2: