Lineage for d6yduf_ (6ydu F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699320Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2699321Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2699383Protein automated matches [369668] (2 species)
    not a true protein
  7. 2699387Species Methylosinus trichosporium [TaxId:595536] [392672] (12 PDB entries)
  8. 2699392Domain d6yduf_: 6ydu F: [393625]
    Other proteins in same PDB: d6ydub_, d6ydud_, d6ydug_
    automated match to d1mhyg_
    complexed with fe, gol

Details for d6yduf_

PDB Entry: 6ydu (more details), 1.95 Å

PDB Description: xfel structure of the soluble methane monooxygenase hydroxylase and regulatory subunit complex, from methylosinus trichosporium ob3b, reoxidized diferric state, 10s o2 exposure.
PDB Compounds: (F:) Methane monooxygenase

SCOPe Domain Sequences for d6yduf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yduf_ a.23.3.1 (F:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaerihiefrqlykp
pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq

SCOPe Domain Coordinates for d6yduf_:

Click to download the PDB-style file with coordinates for d6yduf_.
(The format of our PDB-style files is described here.)

Timeline for d6yduf_: