Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins) |
Protein automated matches [369668] (2 species) not a true protein |
Species Methylosinus trichosporium [TaxId:595536] [392672] (12 PDB entries) |
Domain d6yduf_: 6ydu F: [393625] Other proteins in same PDB: d6ydub_, d6ydud_, d6ydug_ automated match to d1mhyg_ complexed with fe, gol |
PDB Entry: 6ydu (more details), 1.95 Å
SCOPe Domain Sequences for d6yduf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yduf_ a.23.3.1 (F:) automated matches {Methylosinus trichosporium [TaxId: 595536]} akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaerihiefrqlykp pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq
Timeline for d6yduf_: