Lineage for d1cg2a2 (1cg2 A:214-326)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133981Superfamily d.58.19: Carboxypeptidase G2, dimerisation domain [55031] (1 family) (S)
  5. 133982Family d.58.19.1: Carboxypeptidase G2, dimerisation domain [55032] (1 protein)
  6. 133983Protein Carboxypeptidase G2, dimerisation domain [55033] (1 species)
  7. 133984Species Pseudomonas sp., strain rs-16 [TaxId:306] [55034] (1 PDB entry)
  8. 133985Domain d1cg2a2: 1cg2 A:214-326 [39360]
    Other proteins in same PDB: d1cg2a1, d1cg2b1, d1cg2c1, d1cg2d1

Details for d1cg2a2

PDB Entry: 1cg2 (more details), 2.5 Å

PDB Description: carboxypeptidase g2

SCOP Domain Sequences for d1cg2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg2a2 d.58.19.1 (A:214-326) Carboxypeptidase G2, dimerisation domain {Pseudomonas sp., strain rs-16}
sgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnwtiakagnv
sniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrpa

SCOP Domain Coordinates for d1cg2a2:

Click to download the PDB-style file with coordinates for d1cg2a2.
(The format of our PDB-style files is described here.)

Timeline for d1cg2a2: