Lineage for d5ruba2 (5rub A:2-137)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1205860Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 1205861Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1205862Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1205992Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries)
  8. 1205993Domain d5ruba2: 5rub A:2-137 [39288]
    Other proteins in same PDB: d5ruba1, d5rubb1

Details for d5ruba2

PDB Entry: 5rub (more details), 1.7 Å

PDB Description: crystallographic refinement and structure of ribulose-1,5-bisphosphate carboxylase from rhodospirillum rubrum at 1.7 angstroms resolution
PDB Compounds: (A:) rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)

SCOPe Domain Sequences for d5ruba2:

Sequence, based on SEQRES records: (download)

>d5ruba2 d.58.9.1 (A:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttd
dftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveya
kmhdfyvpeayralfd

Sequence, based on observed residues (ATOM records): (download)

>d5ruba2 d.58.9.1 (A:2-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtrgvdalvy
evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
ralfd

SCOPe Domain Coordinates for d5ruba2:

Click to download the PDB-style file with coordinates for d5ruba2.
(The format of our PDB-style files is described here.)

Timeline for d5ruba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ruba1