SCOPe 2.07: Domain d6vrgb2: 6vrg B:56-210

Lineage for d6vrgb2 (6vrg B:56-210)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)

8. Domain d6vrgb2: 6vrg B:56-210 [392796]
   Other proteins in same PDB: d6vrga1, d6vrgb1, d6vrgc1, d6vrgd1
   automated match to d1k6ya2
   complexed with k, po4, zn

Details for d6vrgb2

PDB Entry: 6vrg, 2.4 Å

PDB Description: structure of hiv-1 integrase with native amino-terminal sequence

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d6vrgb2:

Sequence, based on SEQRES records:

>d6vrgb2 c.55.3.2 (B:56-210) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records):

>d6vrgb2 c.55.3.2 (B:56-210) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqeviesmnkelkkiigqvrdqaehlktavqmavfihnkk
rkggiggysagerivdiiatdiqt

Timeline for d6vrgb2:

• d6vrgb2 is new in SCOPe 2.07-stable
  
• d6vrgb2 appears in the current release, SCOPe 2.08