Lineage for d1k6ya2 (1k6y A:56-210)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2493949Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2493955Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)
  8. 2494039Domain d1k6ya2: 1k6y A:56-210 [68240]
    Other proteins in same PDB: d1k6ya1, d1k6yb1, d1k6yc1, d1k6yd1
    complexed with k, po4, zn

Details for d1k6ya2

PDB Entry: 1k6y (more details), 2.4 Å

PDB Description: Crystal Structure of a Two-Domain Fragment of HIV-1 Integrase
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d1k6ya2:

Sequence, based on SEQRES records: (download)

>d1k6ya2 c.55.3.2 (A:56-210) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records): (download)

>d1k6ya2 c.55.3.2 (A:56-210) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgviesmnkelkkiigqvrdqaehlktavqmavfihn
kkrkggiggysagerivdiiatdiqt

SCOPe Domain Coordinates for d1k6ya2:

Click to download the PDB-style file with coordinates for d1k6ya2.
(The format of our PDB-style files is described here.)

Timeline for d1k6ya2: