![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families) ![]() |
![]() | Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein) Zn-binding site is near the C-terminus |
![]() | Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries) |
![]() | Domain d1k6yc1: 1k6y C:1-46 [68243] Other proteins in same PDB: d1k6ya2, d1k6yb2, d1k6yc2, d1k6yd2 complexed with k, po4, zn |
PDB Entry: 1k6y (more details), 2.4 Å
SCOPe Domain Sequences for d1k6yc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6yc1 a.4.10.1 (C:1-46) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]} fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlk
Timeline for d1k6yc1: