Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [228629] (7 PDB entries) |
Domain d6vimf1: 6vim F:3-132 [392709] Other proteins in same PDB: d6vima2, d6vimb2, d6vimc2, d6vimd2, d6vime2, d6vimf2, d6vimg2, d6vimh2 automated match to d2mnra2 complexed with edo, mg, pbc |
PDB Entry: 6vim (more details), 2 Å
SCOPe Domain Sequences for d6vimf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vimf1 d.54.1.0 (F:3-132) automated matches {Pseudomonas putida [TaxId: 303]} evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp lvkllganar
Timeline for d6vimf1: