SCOPe 2.07: Domain d6vimf1: 6vim F:3-132

Lineage for d6vimf1 (6vim F:3-132)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [228629] (7 PDB entries)

8. Domain d6vimf1: 6vim F:3-132 [392709]
   Other proteins in same PDB: d6vima2, d6vimb2, d6vimc2, d6vimd2, d6vime2, d6vimf2, d6vimg2, d6vimh2
   automated match to d2mnra2
   complexed with edo, mg, pbc

Details for d6vimf1

PDB Entry: 6vim, 2 Å

PDB Description: p. putida mandelate racemase co-crystallized with phenylboronic acid

PDB Compounds: (F:) mandelate racemase

SCOPe Domain Sequences for d6vimf1:

Sequence; same for both SEQRES and ATOM records:

>d6vimf1 d.54.1.0 (F:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

Timeline for d6vimf1:

• d6vimf1 is new in SCOPe 2.07-stable
  
• d6vimf1 appears in the current release, SCOPe 2.08