SCOPe 2.07: Domain d6vima2: 6vim A:133-359

Lineage for d6vima2 (6vim A:133-359)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)

binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily

Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
Protein automated matches [226997] (13 species)
not a true protein
Species Pseudomonas putida [TaxId:303] [228631] (7 PDB entries)
Domain d6vima2: 6vim A:133-359 [392664]
Other proteins in same PDB: d6vima1, d6vimb1, d6vimc1, d6vimd1, d6vime1, d6vimf1, d6vimg1, d6vimh1
automated match to d1dtna1
complexed with edo, mg, pbc

Details for d6vima2

PDB Entry: 6vim (more details), 2 Å

PDB Description: p. putida mandelate racemase co-crystallized with phenylboronic acid

PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d6vima2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vima2 c.1.11.2 (A:133-359) automated matches {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

SCOPe Domain Coordinates for d6vima2:

Click to download the PDB-style file with coordinates for d6vima2.
(The format of our PDB-style files is described here.)

Timeline for d6vima2: