SCOPe 2.07: Domain d6vcdc1: 6vcd C:2-67

Lineage for d6vcdc1 (6vcd C:2-67)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)

8. Domain d6vcdc1: 6vcd C:2-67 [392618]
   Other proteins in same PDB: d6vcdc2
   automated match to d5k35b1
   complexed with fes

Details for d6vcdc1

PDB Entry: 6vcd, 3 Å

PDB Description: cryo-em structure of irp2-fbxl5-skp1 complex

PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6vcdc1:

Sequence, based on SEQRES records:

>d6vcdc1 d.42.1.0 (C:2-67) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
cthhkd

Sequence, based on observed residues (ATOM records):

>d6vcdc1 d.42.1.0 (C:2-67) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgdpvplpnvnaailkkviqwcthhkd

Timeline for d6vcdc1:

• d6vcdc1 is new in SCOPe 2.07-stable
  
• d6vcdc1 appears in the current release, SCOPe 2.08