PDB entry 6vcd

View 6vcd on RCSB PDB site
Description: Cryo-EM structure of IRP2-FBXL5-SKP1 complex
Class: ligase
Keywords: E3 ligase, [2Fe-2S] cluster, Iron metabolism, LIGASE
Deposited on 2019-12-20, released 2020-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: EM
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Iron-responsive element binding protein 2, isoform CRA_a
  Species: Homo sapiens [TaxId:9606]
  Gene: IREB2, hCG_38938
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3DW85 (Start-962)
• Chain 'B':
  Compound: F-box/LRR-repeat protein 5
  Species: Homo sapiens [TaxId:9606]
  Gene: FBXL5, FBL4, FBL5, FLR1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UKA1 (Start-491)
• Chain 'C':
  Compound: S-phase kinase-associated protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63208
  Domains in SCOPe 2.07: d6vcdc1, d6vcdc2
• Heterogens: FES

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >6vcdC (C:)
  mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
  wcthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtc
  ktvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6vcdC (C:)
  psiklqssdgeifevdveiakqsvtiktmledlgdpvplpnvnaailkkviqwcthhkdi
  pvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikndf
  teeeeaqvrkenqwc