Lineage for d1ausl2 (1aus L:20-147)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724752Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 724753Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 724754Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 724864Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 724885Domain d1ausl2: 1aus L:20-147 [39261]
    Other proteins in same PDB: d1ausl1, d1ausm1, d1ausn1, d1auso1, d1auss_, d1aust_, d1ausu_, d1ausv_
    complexed with cbx, mg

Details for d1ausl2

PDB Entry: 1aus (more details), 2.2 Å

PDB Description: activated unliganded spinach rubisco
PDB Compounds: (L:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1ausl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ausl2 d.58.9.1 (L:20-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
ipvayvkt

SCOP Domain Coordinates for d1ausl2:

Click to download the PDB-style file with coordinates for d1ausl2.
(The format of our PDB-style files is described here.)

Timeline for d1ausl2: