Lineage for d1ausl2 (1aus L:20-147)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32762Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 32763Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 32764Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 32786Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 32807Domain d1ausl2: 1aus L:20-147 [39261]
    Other proteins in same PDB: d1ausl1, d1auss_

Details for d1ausl2

PDB Entry: 1aus (more details), 2.2 Å

PDB Description: activated unliganded spinach rubisco

SCOP Domain Sequences for d1ausl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ausl2 d.58.9.1 (L:20-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
ipvayvkt

SCOP Domain Coordinates for d1ausl2:

Click to download the PDB-style file with coordinates for d1ausl2.
(The format of our PDB-style files is described here.)

Timeline for d1ausl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ausl1
View in 3D
Domains from other chains:
(mouse over for more information)
d1auss_