Lineage for d6usdb_ (6usd B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2328987Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) (S)
    contains one classic and one pseudo HhH motifs
    automatically mapped to Pfam PF02961
  5. 2328988Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins)
  6. 2328989Protein Barrier-to-autointegration factor, BAF [47800] (1 species)
  7. 2328990Species Human (Homo sapiens) [TaxId:9606] [47801] (23 PDB entries)
  8. 2329004Domain d6usdb_: 6usd B: [392428]
    automated match to d1ci4a_
    complexed with eoh

Details for d6usdb_

PDB Entry: 6usd (more details), 1.65 Å

PDB Description: barrier-to-autointegration factor soaked in ethanol: 1 of 14 in mscs set
PDB Compounds: (B:) barrier-to-autointegration factor

SCOPe Domain Sequences for d6usdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6usdb_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
ttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfre
wlkdtcganakqsrdcfgclrewcdafl

SCOPe Domain Coordinates for d6usdb_:

Click to download the PDB-style file with coordinates for d6usdb_.
(The format of our PDB-style files is described here.)

Timeline for d6usdb_: