Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) contains one classic and one pseudo HhH motifs automatically mapped to Pfam PF02961 |
Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins) |
Protein Barrier-to-autointegration factor, BAF [47800] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47801] (23 PDB entries) |
Domain d6us7b_: 6us7 B: [392403] automated match to d1ci4a_ complexed with eoh |
PDB Entry: 6us7 (more details), 1.65 Å
SCOPe Domain Sequences for d6us7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6us7b_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]} ttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfre wlkdtcganakqsrdcfgclrewcdafl
Timeline for d6us7b_: