SCOPe 2.08: Domain d1vhib_: 1vhi B:

Lineage for d1vhib_ (1vhi B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species)
   DNA-binding mode differs from that of E2 protein

7. Species Epstein-Barr virus [TaxId:10376] [54965] (2 PDB entries)

8. Domain d1vhib_: 1vhi B: [39231]
   has additional insertions and/or extensions that are not grouped together

Details for d1vhib_

PDB Entry: 1vhi, 2.5 Å

PDB Description: epstein barr virus nuclear antigen-1 dna-binding domain, residues 470-607

PDB Compounds: (B:) epstein barr virus nuclear antigen-1

SCOPe Domain Sequences for d1vhib_:

Sequence; same for both SEQRES and ATOM records:

>d1vhib_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-Barr virus [TaxId: 10376]}
pkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrltp
lsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnirv
tvcsfddgvdlp

Timeline for d1vhib_:

• d1vhib_ first appeared (with stable ids) in SCOP 1.55
  
• d1vhib_ appears in SCOPe 2.07