SCOPe 2.07: Domain d6ucda1: 6ucd A:7-94

Lineage for d6ucda1 (6ucd A:7-94)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries)

8. Domain d6ucda1: 6ucd A:7-94 [392283]
   Other proteins in same PDB: d6ucda2, d6ucdb1
   automated match to d3r2ta1

Details for d6ucda1

PDB Entry: 6ucd, 2.85 Å

PDB Description: the crystal structure of staphylococcus aureus super antigen-like protein ssl10

PDB Compounds: (A:) Exotoxin

SCOPe Domain Sequences for d6ucda1:

Sequence, based on SEQRES records:

>d6ucda1 b.40.2.0 (A:7-94) automated matches {Staphylococcus aureus [TaxId: 1280]}
vnkhdkealyryytgktmemknisalkhgknnlrfkfrgikiqvllpgndkskfqqrsye
gldvffvqekrdkhdifytvggviqnnk

Sequence, based on observed residues (ATOM records):

>d6ucda1 b.40.2.0 (A:7-94) automated matches {Staphylococcus aureus [TaxId: 1280]}
vnkhdkealyryytgtmemknisalhgknnlrfkfgikiqvllpgldvffvqekrdkhdi
fytvggviqnnk

Timeline for d6ucda1:

• d6ucda1 is new in SCOPe 2.07-stable
  
• d6ucda1 appears in the current release, SCOPe 2.08