Lineage for d6ucdb1 (6ucd B:95-196)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541693Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2541694Protein automated matches [226841] (6 species)
    not a true protein
  7. 2541725Species Staphylococcus aureus [TaxId:93061] [226096] (8 PDB entries)
  8. 2541743Domain d6ucdb1: 6ucd B:95-196 [392295]
    Other proteins in same PDB: d6ucda1
    automated match to d3r2ta2

Details for d6ucdb1

PDB Entry: 6ucd (more details), 2.85 Å

PDB Description: the crystal structure of staphylococcus aureus super antigen-like protein ssl10
PDB Compounds: (B:) Exotoxin

SCOPe Domain Sequences for d6ucdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ucdb1 d.15.6.0 (B:95-196) automated matches {Staphylococcus aureus [TaxId: 93061]}
tsgvvsapilniskekgedafvkgypyyikkekitlkeldyklrkhliekyglyktiskd
grvkislkdgsfynldlrsklkfkymgevieskqikdievnl

SCOPe Domain Coordinates for d6ucdb1:

Click to download the PDB-style file with coordinates for d6ucdb1.
(The format of our PDB-style files is described here.)

Timeline for d6ucdb1: