Lineage for d1ft8e1 (1ft8 E:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80286Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 80385Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 80386Protein mRNA export factor tap [54955] (1 species)
  7. 80387Species Human (Homo sapiens) [TaxId:9606] [54956] (2 PDB entries)
  8. 80391Domain d1ft8e1: 1ft8 E: [39216]
    Other proteins in same PDB: d1ft8a1, d1ft8b1, d1ft8c1, d1ft8d1

Details for d1ft8e1

PDB Entry: 1ft8 (more details), 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

SCOP Domain Sequences for d1ft8e1:

Sequence, based on SEQRES records: (download)

>d1ft8e1 d.58.7.2 (E:) mRNA export factor tap {Human (Homo sapiens)}
wfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkav

Sequence, based on observed residues (ATOM records): (download)

>d1ft8e1 d.58.7.2 (E:) mRNA export factor tap {Human (Homo sapiens)}
wfkitdkawllsmiqskcsvpftpiefhqffvedastasalkav

SCOP Domain Coordinates for d1ft8e1:

Click to download the PDB-style file with coordinates for d1ft8e1.
(The format of our PDB-style files is described here.)

Timeline for d1ft8e1: