Lineage for d6tral_ (6tra L:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633219Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 2633220Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 2633221Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins)
  6. 2633225Protein automated matches [347525] (2 species)
    not a true protein
  7. 2633231Species Thermosynechococcus elongatus [TaxId:197221] [377769] (4 PDB entries)
  8. 2633232Domain d6tral_: 6tra L: [392116]
    Other proteins in same PDB: d6traa_, d6trab_, d6trac_, d6trad_, d6trae_, d6traf_, d6trai_, d6traj_, d6tram_
    automated match to d1jb0l_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6tral_

PDB Entry: 6tra (more details), 2.85 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (L:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d6tral_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tral_ f.31.1.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpw
vklgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqfta
gffvgamgsafvaffllenflvvdgimtglfn

SCOPe Domain Coordinates for d6tral_:

Click to download the PDB-style file with coordinates for d6tral_.
(The format of our PDB-style files is described here.)

Timeline for d6tral_: