Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) automatically mapped to Pfam PF02605 |
Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins) |
Protein automated matches [347525] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [377769] (4 PDB entries) |
Domain d6tral_: 6tra L: [392116] Other proteins in same PDB: d6traa_, d6trab_, d6trac_, d6trad_, d6trae_, d6traf_, d6trai_, d6traj_, d6tram_ automated match to d1jb0l_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6tra (more details), 2.85 Å
SCOPe Domain Sequences for d6tral_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tral_ f.31.1.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} elvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpw vklgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqfta gffvgamgsafvaffllenflvvdgimtglfn
Timeline for d6tral_: