Lineage for d6trai_ (6tra I:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631519Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) (S)
  5. 2631520Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)
  6. 2631521Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species)
  7. 2631524Species Thermosynechococcus elongatus [TaxId:197221] [377780] (4 PDB entries)
  8. 2631525Domain d6trai_: 6tra I: [392100]
    Other proteins in same PDB: d6traa_, d6trab_, d6trac_, d6trad_, d6trae_, d6traf_, d6traj_, d6tral_, d6tram_
    automated match to d1jb0i_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trai_

PDB Entry: 6tra (more details), 2.85 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (I:) Photosystem I reaction center subunit VIII

SCOPe Domain Sequences for d6trai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trai_ f.23.17.1 (I:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

SCOPe Domain Coordinates for d6trai_:

Click to download the PDB-style file with coordinates for d6trai_.
(The format of our PDB-style files is described here.)

Timeline for d6trai_: