Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) |
Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins) |
Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [377780] (4 PDB entries) |
Domain d6trai_: 6tra I: [392100] Other proteins in same PDB: d6traa_, d6trab_, d6trac_, d6trad_, d6trae_, d6traf_, d6traj_, d6tral_, d6tram_ automated match to d1jb0i_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6tra (more details), 2.85 Å
SCOPe Domain Sequences for d6trai_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trai_ f.23.17.1 (I:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]} mmgsyaasflpwifipvvcwlmptvvmgllflyiegea
Timeline for d6trai_: