SCOPe 2.03: Domain d1cvjf2: 1cvj F:91-173

Lineage for d1cvjf2 (1cvj F:91-173)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Poly(A)-binding protein [54948] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)

8. Domain d1cvjf2: 1cvj F:91-173 [39202]
   protein/RNA complex; complexed with a

Details for d1cvjf2

PDB Entry: 1cvj, 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

PDB Compounds: (F:) polyadenylate binding protein 1

SCOPe Domain Sequences for d1cvjf2:

Sequence, based on SEQRES records:

>d1cvjf2 d.58.7.1 (F:91-173) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqea
aeraiekmngmllndrkvfvgrf

Sequence, based on observed residues (ATOM records):

>d1cvjf2 d.58.7.1 (F:91-173) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}
pslrksgvgninkalydtfsafgnilsckvvcskgygfvhfetqevfvgrf

Timeline for d1cvjf2:

• d1cvjf2 first appeared (with stable ids) in SCOP 1.55
  
• d1cvjf2 appears in SCOPe 2.02
  
• d1cvjf2 appears in SCOPe 2.04
  
• d1cvjf2 appears in the current release, SCOPe 2.08