Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) |
Family d.58.7.1: Canonical RBD [54929] (12 proteins) |
Protein Poly(A)-binding protein [54948] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry) |
Domain d1cvjd1: 1cvj D:11-90 [39197] |
PDB Entry: 1cvj (more details), 2.6 Å
SCOP Domain Sequences for d1cvjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvjd1 d.58.7.1 (D:11-90) Poly(A)-binding protein {Human (Homo sapiens)} aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald tmnfdvikgkpvrimwsqrd
Timeline for d1cvjd1: