Lineage for d1cvjh1 (1cvj H:11-90)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. 32673Protein Poly(A)-binding protein [54948] (1 species)
  7. 32674Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
  8. 32689Domain d1cvjh1: 1cvj H:11-90 [39205]

Details for d1cvjh1

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna
PDB Compounds: (H:)

SCOP Domain Sequences for d1cvjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvjh1 d.58.7.1 (H:11-90) Poly(A)-binding protein {Human (Homo sapiens)}
aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
tmnfdvikgkpvrimwsqrd

SCOP Domain Coordinates for d1cvjh1:

Click to download the PDB-style file with coordinates for d1cvjh1.
(The format of our PDB-style files is described here.)

Timeline for d1cvjh1: