Lineage for d6sqia1 (6sqi A:52-378)
Root: SCOPe 2.08 
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.0: automated matches [191451] (1 protein)
not a true familyProtein automated matches [190689] (87 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187843] (21 PDB entries) 
Domain d6sqia1: 6sqi A:52-378 [391723]
Other proteins in same PDB: d6sqia2
automated match to d5egsb_
complexed with ca
Details for d6sqia1
PDB Entry: 6sqi (more details), 1.6 Å
PDB Description: crystal structure of mouse prmt6 with c-terminal tev cleavage site
PDB Compounds: (A:) Protein arginine N-methyltransferase 6SCOPe Domain Sequences for d6sqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sqia1 c.66.1.0 (A:52-378) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ecysdvsvheemiadqvrteayrlgilknwaalrgktvldvgagtgilsifcaqagarrv
yaveasaiwqqarevvrlngledrvhvlpgpvetvelpervdaivsewmgygllhesmls
svlhartkwlkegglllpasaelfvapisdqmlewrlgfwsqvkqhygvdmscmesfatr
clmghseivvqdlsgedvlarpqrfaqlelaragleqeleagvggrfrcscygsaplhgf
avwfqvtfpggdsekplvlstsplhpathwkqallylnepvpveqdtdisgeitllpspd
nprrlrillrykvgdheektkdfamed
SCOPe Domain Coordinates for d6sqia1:
Click to download the PDB-style file with coordinates for d6sqia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6sqia1:
- d6sqia1 first appeared in SCOPe 2.07
View in 3D
