Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (19 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (39 PDB entries) |
Domain d6q0de1: 6q0d E:1-159 [391204] Other proteins in same PDB: d6q0da2, d6q0db2, d6q0dc2, d6q0dd2, d6q0de2, d6q0df2 automated match to d4jnka1 complexed with gol, nai, p8m, po4 |
PDB Entry: 6q0d (more details), 2.05 Å
SCOPe Domain Sequences for d6q0de1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q0de1 c.2.1.5 (E:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d6q0de1: