Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
Superfamily d.294.1: EndoU-like [142877] (3 families) similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
Family d.294.1.0: automated matches [356574] (1 protein) not a true family |
Protein automated matches [356575] (3 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382219] (6 PDB entries) |
Domain d7k1oa2: 7k1o A:192-346 [390395] Other proteins in same PDB: d7k1oa1, d7k1oa3, d7k1ob1, d7k1ob3, d7k1oc1, d7k1oc3 automated match to d2h85a2 complexed with edo, vqv |
PDB Entry: 7k1o (more details), 2.4 Å
SCOPe Domain Sequences for d7k1oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k1oa2 d.294.1.0 (A:192-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd lsvvskvvkvtidyteisfmlwckdghvetfypkl
Timeline for d7k1oa2: