Lineage for d5at1d1 (5at1 D:8-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723615Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 723616Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 723617Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 723621Species Escherichia coli [TaxId:562] [54896] (41 PDB entries)
  8. 723641Domain d5at1d1: 5at1 D:8-100 [39022]
    Other proteins in same PDB: d5at1a1, d5at1a2, d5at1b2, d5at1c1, d5at1c2, d5at1d2
    complexed with ctp, zn

Details for d5at1d1

PDB Entry: 5at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d5at1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5at1d1 d.58.2.1 (D:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d5at1d1:

Click to download the PDB-style file with coordinates for d5at1d1.
(The format of our PDB-style files is described here.)

Timeline for d5at1d1: