Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species) |
Species Escherichia coli [TaxId:562] [53674] (45 PDB entries) |
Domain d5at1a1: 5at1 A:1-150 [35116] Other proteins in same PDB: d5at1b1, d5at1b2, d5at1d1, d5at1d2 |
PDB Entry: 5at1 (more details), 2.6 Å
SCOP Domain Sequences for d5at1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5at1a1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqqteg
Timeline for d5at1a1: