Lineage for d7jh4a_ (7jh4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569893Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2569894Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2570050Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2570051Protein automated matches [190672] (29 species)
    not a true protein
  7. 2570150Species Staphylococcus aureus [TaxId:46170] [390184] (1 PDB entry)
  8. 2570151Domain d7jh4a_: 7jh4 A: [390186]
    automated match to d2haya_
    complexed with fnr, nad

Details for d7jh4a_

PDB Entry: 7jh4 (more details), 2 Å

PDB Description: crystal structure of nad(p)h-flavin oxidoreductase (nfor) from s. aureus complexed with reduced fmn and nad+
PDB Compounds: (A:) NAD(P)H-dependent oxidoreductase

SCOPe Domain Sequences for d7jh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jh4a_ d.90.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 46170]}
msnmnqtimdafhfrhatkqfdpqkkvskedfetilesgrlspsslglepwkfvviqdqa
lrdelkahswgaakqldtashfvlifarknvtsrspyvqhmlrdikkyeaqtipaveqkf
dafqadfhisdndqalydwsskqtyialgnmmttaallgidscpmegfsldtvtdilank
gildteqfglsvmvafgyrqqdppknktrqayedviewvgpke

SCOPe Domain Coordinates for d7jh4a_:

Click to download the PDB-style file with coordinates for d7jh4a_.
(The format of our PDB-style files is described here.)

Timeline for d7jh4a_: