Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (29 species) not a true protein |
Species Staphylococcus aureus [TaxId:46170] [390184] (1 PDB entry) |
Domain d7jh4a_: 7jh4 A: [390186] automated match to d2haya_ complexed with fnr, nad |
PDB Entry: 7jh4 (more details), 2 Å
SCOPe Domain Sequences for d7jh4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jh4a_ d.90.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 46170]} msnmnqtimdafhfrhatkqfdpqkkvskedfetilesgrlspsslglepwkfvviqdqa lrdelkahswgaakqldtashfvlifarknvtsrspyvqhmlrdikkyeaqtipaveqkf dafqadfhisdndqalydwsskqtyialgnmmttaallgidscpmegfsldtvtdilank gildteqfglsvmvafgyrqqdppknktrqayedviewvgpke
Timeline for d7jh4a_:
View in 3D Domains from other chains: (mouse over for more information) d7jh4b_, d7jh4c_, d7jh4d_, d7jh4e_ |