Lineage for d1h7xa5 (1h7x A:845-1017)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026489Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1026616Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1026631Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 1026632Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries)
  8. 1026641Domain d1h7xa5: 1h7x A:845-1017 [39011]
    Other proteins in same PDB: d1h7xa1, d1h7xa2, d1h7xa3, d1h7xa4, d1h7xb1, d1h7xb2, d1h7xb3, d1h7xb4, d1h7xc1, d1h7xc2, d1h7xc3, d1h7xc4, d1h7xd1, d1h7xd2, d1h7xd3, d1h7xd4
    complexed with fad, fmn, ndp, sf4, urf; mutant

Details for d1h7xa5

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil
PDB Compounds: (A:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7xa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xa5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl

SCOPe Domain Coordinates for d1h7xa5:

Click to download the PDB-style file with coordinates for d1h7xa5.
(The format of our PDB-style files is described here.)

Timeline for d1h7xa5: