Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Fe-only hydrogenase larger subunit, N-domain [54887] (1 species) |
Species Desulfovibrio desulfuricans [TaxId:876] [54888] (1 PDB entry) |
Domain d1hfel2: 1hfe L:2-86 [39001] Other proteins in same PDB: d1hfel1, d1hfem1, d1hfes_, d1hfet_ complexed with cmo, cyn, cys, fe2, pdt, sf4, zn |
PDB Entry: 1hfe (more details), 1.6 Å
SCOPe Domain Sequences for d1hfel2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} srtvmerieyemhtpdpkadpdklhfvqideakcigcdtcsqycptaaifgemgephsip hieacincgqclthcpenaiyeaqs
Timeline for d1hfel2:
View in 3D Domains from other chains: (mouse over for more information) d1hfem1, d1hfem2, d1hfes_, d1hfet_ |