Lineage for d1hfel2 (1hfe L:2-86)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192801Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2192882Protein Fe-only hydrogenase larger subunit, N-domain [54887] (1 species)
  7. 2192883Species Desulfovibrio desulfuricans [TaxId:876] [54888] (1 PDB entry)
  8. 2192884Domain d1hfel2: 1hfe L:2-86 [39001]
    Other proteins in same PDB: d1hfel1, d1hfem1, d1hfes_, d1hfet_
    complexed with cmo, cyn, cys, fe2, pdt, sf4, zn

Details for d1hfel2

PDB Entry: 1hfe (more details), 1.6 Å

PDB Description: 1.6 a resolution structure of the fe-only hydrogenase from desulfovibrio desulfuricans
PDB Compounds: (L:) protein (fe-only hydrogenase (e.c.1.18.99.1) (larger subunit))

SCOPe Domain Sequences for d1hfel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]}
srtvmerieyemhtpdpkadpdklhfvqideakcigcdtcsqycptaaifgemgephsip
hieacincgqclthcpenaiyeaqs

SCOPe Domain Coordinates for d1hfel2:

Click to download the PDB-style file with coordinates for d1hfel2.
(The format of our PDB-style files is described here.)

Timeline for d1hfel2: