Lineage for d1b0vb_ (1b0v B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80005Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 80021Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein)
  6. 80022Protein Ferredoxin [54871] (2 species)
  7. 80023Species Azotobacter vinelandii [TaxId:354] [54872] (30 PDB entries)
  8. 80058Domain d1b0vb_: 1b0v B: [38983]

Details for d1b0vb_

PDB Entry: 1b0v (more details), 2.8 Å

PDB Description: i40n mutant of azotobacter vinelandii fdi

SCOP Domain Sequences for d1b0vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0vb_ d.58.1.2 (B:) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecndcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOP Domain Coordinates for d1b0vb_:

Click to download the PDB-style file with coordinates for d1b0vb_.
(The format of our PDB-style files is described here.)

Timeline for d1b0vb_: