Lineage for d7c0cj_ (7c0c J:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444660Species Azospirillum brasilense [TaxId:192] [225809] (5 PDB entries)
  8. 2444684Domain d7c0cj_: 7c0c J: [389771]
    automated match to d3fkka_

Details for d7c0cj_

PDB Entry: 7c0c (more details), 1.9 Å

PDB Description: crystal structure of azospirillum brasilense l-2-keto-3-deoxyarabonate dehydratase (apo form)
PDB Compounds: (J:) L-2-keto-3-deoxyarabonate dehydratase

SCOPe Domain Sequences for d7c0cj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c0cj_ c.1.10.0 (J:) automated matches {Azospirillum brasilense [TaxId: 192]}
tprhrgifpvvpttfadtgeldlasqkravdfmidagsdglcilanfseqfaitdderdv
ltrtilehvagrvpvivttshystqvcaarslraqqlgaamvmamppyhgatfrvpeaqi
fefyarvsdaiaipimvqdapasgtalsapflarmareieqvayfkietpgaanklreli
rlggdaiegpwdgeeaitlladlhagatgamtgggfpdgirpileawregrhddayaryq
awlplinhenrqsgiltakalmreggviaserprhpmpelhpdtraellaiarrldplvl
rwah

SCOPe Domain Coordinates for d7c0cj_:

Click to download the PDB-style file with coordinates for d7c0cj_.
(The format of our PDB-style files is described here.)

Timeline for d7c0cj_: