SCOPe 2.08: Domain d7bzca2: 7bzc A:226-555

Lineage for d7bzca2 (7bzc A:226-555)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279296] (5 PDB entries)

8. Domain d7bzca2: 7bzc A:226-555 [389710]
   Other proteins in same PDB: d7bzca1
   automated match to d3g4da2
   complexed with fps, mg

Details for d7bzca2

PDB Entry: 7bzc, 2.3 Å

PDB Description: crystal structure of plant sesterterpene synthase attps18 complexed with farnesyl thiolodiphosphate (fspp)

PDB Compounds: (A:) Terpenoid synthase 18

SCOPe Domain Sequences for d7bzca2:

Sequence; same for both SEQRES and ATOM records:

>d7bzca2 a.128.1.0 (A:226-555) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hnkillkfaklnfnfcqfhyiqelktltkwwkdldlasklpyirdrlveshlgglgpyfe
physlgriivakiimtmvvvddtydahatvpevavlteclqrlnigaddklpdylrtvle
svfevmgeieqemrpkgrsygvkqvlerfknvakadkqltewartgdvpsfdeymkvglv
tagmdgyagycfigmedvsekeafewlssnpliiqalnvmfrlandvgtyeteinrgeva
nglncymkqygvtkeeasqelrkiysnnkkvvmeefmnshdhvprqvllrclnfarlfdv
mytegdgysepkgkiehfmtslyvhpipls

Timeline for d7bzca2:

• d7bzca2 first appeared in SCOPe 2.07