Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279296] (5 PDB entries) |
Domain d7bzca2: 7bzc A:226-555 [389710] Other proteins in same PDB: d7bzca1 automated match to d3g4da2 complexed with fps, mg |
PDB Entry: 7bzc (more details), 2.3 Å
SCOPe Domain Sequences for d7bzca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bzca2 a.128.1.0 (A:226-555) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} hnkillkfaklnfnfcqfhyiqelktltkwwkdldlasklpyirdrlveshlgglgpyfe physlgriivakiimtmvvvddtydahatvpevavlteclqrlnigaddklpdylrtvle svfevmgeieqemrpkgrsygvkqvlerfknvakadkqltewartgdvpsfdeymkvglv tagmdgyagycfigmedvsekeafewlssnpliiqalnvmfrlandvgtyeteinrgeva nglncymkqygvtkeeasqelrkiysnnkkvvmeefmnshdhvprqvllrclnfarlfdv mytegdgysepkgkiehfmtslyvhpipls
Timeline for d7bzca2: