SCOPe 2.08: Domain d7bzkb_: 7bzk B:

Lineage for d7bzkb_ (7bzk B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)

8. Domain d7bzkb_: 7bzk B: [389709]
   Other proteins in same PDB: d7bzka_
   automated match to d2cvka_
   complexed with sf4

Details for d7bzkb_

PDB Entry: 7bzk, 1.59 Å

PDB Description: crystal structure of ferredoxin: thioredoxin reductase and thioredoxin y1 complex

PDB Compounds: (B:) Thioredoxin Y1, chloroplastic

SCOPe Domain Sequences for d7bzkb_:

Sequence; same for both SEQRES and ATOM records:

>d7bzkb_ c.47.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qtfdsfedllvnsdkpvlvdyyatwcgpsqfmvpilnevsetlkdkiqvvkidtekypsi
ankykiealptfilfkdgepcdrfegaltakqliqriedslk

Timeline for d7bzkb_:

• d7bzkb_ first appeared in SCOPe 2.07