Lineage for d1frj__ (1frj -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80005Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 80021Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein)
  6. 80022Protein Ferredoxin [54871] (2 species)
  7. 80023Species Azotobacter vinelandii [TaxId:354] [54872] (30 PDB entries)
  8. 80044Domain d1frj__: 1frj - [38969]

Details for d1frj__

PDB Entry: 1frj (more details), 2.3 Å

PDB Description: azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential

SCOP Domain Sequences for d1frj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frj__ d.58.1.2 (-) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckytdcvevcpvdciyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOP Domain Coordinates for d1frj__:

Click to download the PDB-style file with coordinates for d1frj__.
(The format of our PDB-style files is described here.)

Timeline for d1frj__: