Lineage for d1a6l__ (1a6l -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein) Protein Ferredoxin [54871] (2 species) Species Azotobacter vinelandii [TaxId:354] [54872] (30 PDB entries) 
Domain d1a6l__: 1a6l - [38966]
Details for d1a6l__
PDB Entry: 1a6l (more details), 2.1 Å
PDB Description: t14c mutant of azotobacter vinelandii fdi
SCOP Domain Sequences for d1a6l__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6l__ d.58.1.2 (-) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckycdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
SCOP Domain Coordinates for d1a6l__:
Click to download the PDB-style file with coordinates for d1a6l__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a6l__:
- d1a6l__ first appeared (with stable ids) in SCOP 1.55
- d1a6l__ appears in SCOP 1.59
- d1a6l__ appears in the current release, SCOPe 2.08, called d1a6la_
View in 3D