Lineage for d6wcvb1 (6wcv B:1-245)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978768Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2978769Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. 2978795Species Human (Homo sapiens) [TaxId:9606] [389533] (1 PDB entry)
  8. 2978796Domain d6wcvb1: 6wcv B:1-245 [389534]
    Other proteins in same PDB: d6wcva1, d6wcva2, d6wcva3, d6wcvb2
    automated match to d2nu8b2
    complexed with tuy

Details for d6wcvb1

PDB Entry: 6wcv (more details), 1.52 Å

PDB Description: tartryl-coa bound to human gtp-specific succinyl-coa synthetase
PDB Compounds: (B:) Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d6wcvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wcvb1 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mnlqeyqskklmsdngvrvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfn
sglkggvhltkdpnvvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidifegikdsqaqrmaenlgfvgpl
ksqaadqitklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

SCOPe Domain Coordinates for d6wcvb1:

Click to download the PDB-style file with coordinates for d6wcvb1.
(The format of our PDB-style files is described here.)

Timeline for d6wcvb1: