Lineage for d7bpcc1 (7bpc C:2-337)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2442705Protein automated matches [190150] (34 species)
    not a true protein
  7. 2442756Species Fusarium oxysporum [TaxId:5507] [389224] (3 PDB entries)
  8. 2442767Domain d7bpcc1: 7bpc C:2-337 [389313]
    Other proteins in same PDB: d7bpcc2
    automated match to d2dvxa_
    complexed with gtq, zn

Details for d7bpcc1

PDB Entry: 7bpc (more details), 2.45 Å

PDB Description: crystal structure of 2, 3-dihydroxybenzoic acid decarboxylase from fusarium oxysporum in complex with 2,5-dhba
PDB Compounds: (C:) 2,3-dihydroxybenzoate decarboxylase

SCOPe Domain Sequences for d7bpcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bpcc1 c.1.9.0 (C:2-337) automated matches {Fusarium oxysporum [TaxId: 5507]}
mlgkvaleeafalprhkertrwwaglfaidpdkhaaeinditeqrikymnehgvgytils
ytapgvqdvwdpkeaqalavevndyiadaikahpdrlgafatlsmhdpkeaaeelrrvvt
kygfkgalvndtqragadgddmifydgpewdvfwstvtdldvpfylhprnptgsiheklw
akrswligpplsfaqgvslhalgmvtngvfdrhpklqivlghlgehipfdmwrinhwfed
ikkplglsckltireyfarnlwittsghfststlqfclgevgadrilfsidypfenfsda
ctwydglaindvdkrkigkdnakklfklpqfyqsed

SCOPe Domain Coordinates for d7bpcc1:

Click to download the PDB-style file with coordinates for d7bpcc1.
(The format of our PDB-style files is described here.)

Timeline for d7bpcc1: