Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (34 species) not a true protein |
Species Fusarium oxysporum [TaxId:5507] [389224] (3 PDB entries) |
Domain d7bpcd_: 7bpc D: [389225] Other proteins in same PDB: d7bpcc2 automated match to d2dvxa_ complexed with gtq, zn |
PDB Entry: 7bpc (more details), 2.45 Å
SCOPe Domain Sequences for d7bpcd_:
Sequence, based on SEQRES records: (download)
>d7bpcd_ c.1.9.0 (D:) automated matches {Fusarium oxysporum [TaxId: 5507]} mlgkvaleeafalprhkertrwwaglfaidpdkhaaeinditeqrikymnehgvgytils ytapgvqdvwdpkeaqalavevndyiadaikahpdrlgafatlsmhdpkeaaeelrrvvt kygfkgalvndtqragadgddmifydgpewdvfwstvtdldvpfylhprnptgsiheklw akrswligpplsfaqgvslhalgmvtngvfdrhpklqivlghlgehipfdmwrinhwfed ikkplglsckltireyfarnlwittsghfststlqfclgevgadrilfsidypfenfsda ctwydglaindvdkrkigkdnakklfklp
>d7bpcd_ c.1.9.0 (D:) automated matches {Fusarium oxysporum [TaxId: 5507]} mlgkvaleeafalprhglfaidpdkhaaeinditeqrikymnehgvgytilsytapgvqd vwdpkeaqalavevndyiadaikahpdrlgafatlsmhdpkeaaeelrrvvtkygfkgal vndtqragadgddmifydgpewdvfwstvtdldvpfylhprnptgsiheklwakrswlig pplsfaqgvslhalgmvtngvfdrhpklqivlghlgehipfdmwrinhwfedikkplgls ckltireyfarnlwittsghfststlqfclgevgadrilfsidypfenfsdactwydgla indvdkrkigkdnakklfklp
Timeline for d7bpcd_:
View in 3D Domains from other chains: (mouse over for more information) d7bpca_, d7bpcb_, d7bpcc1, d7bpcc2 |