Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (14 PDB entries) |
Domain d6w0gb1: 6w0g B:1-107 [389177] Other proteins in same PDB: d6w0gb2, d6w0gc_ automated match to d1r3ja1 complexed with k |
PDB Entry: 6w0g (more details), 2.6 Å
SCOPe Domain Sequences for d6w0gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w0gb1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]} dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik
Timeline for d6w0gb1: