SCOPe 2.07: Domain d6m3bb2: 6m3b B:111-215

Lineage for d6m3bb2 (6m3b B:111-215)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6m3bb2: 6m3b B:111-215 [388948]
   Other proteins in same PDB: d6m3ba_, d6m3bb1, d6m3bd1, d6m3bd2
   automated match to d4ocrl2
   complexed with nag

Details for d6m3bb2

PDB Entry: 6m3b, 2.2 Å

PDB Description: hapc-c25k23 fab complex

PDB Compounds: (B:) c25k23 Fab L chain

SCOPe Domain Sequences for d6m3bb2:

Sequence; same for both SEQRES and ATOM records:

>d6m3bb2 b.1.1.2 (B:111-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d6m3bb2:

• d6m3bb2 is new in SCOPe 2.07-stable
  
• d6m3bb2 appears in the current release, SCOPe 2.08