SCOPe 2.07: Domain d6m3bb1: 6m3b B:2-110

Lineage for d6m3bb1 (6m3b B:2-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6m3bb1: 6m3b B:2-110 [388947]
   Other proteins in same PDB: d6m3ba_, d6m3bb2, d6m3bd1, d6m3bd2
   automated match to d4ocrl1
   complexed with nag

Details for d6m3bb1

PDB Entry: 6m3b, 2.2 Å

PDB Description: hapc-c25k23 fab complex

PDB Compounds: (B:) c25k23 Fab L chain

SCOPe Domain Sequences for d6m3bb1:

Sequence; same for both SEQRES and ATOM records:

>d6m3bb1 b.1.1.0 (B:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsasgtpgqrvtisctgsssnigaaydvhwyqqlpgtapklliygnnkrpsgvp
drfsgsksgtsaslaisglrsedeadyycqsydsslsgsvfgggtkltv

Timeline for d6m3bb1:

• d6m3bb1 is new in SCOPe 2.07-stable
  
• d6m3bb1 appears in the current release, SCOPe 2.08