Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
Domain d6kuzb4: 6kuz B:626-730 [388909] Other proteins in same PDB: d6kuza1, d6kuza3, d6kuza5, d6kuzb1, d6kuzb3, d6kuzb5, d6kuzc1, d6kuzc3, d6kuzc5, d6kuzd1, d6kuzd3, d6kuzd5 automated match to d1jz8a2 complexed with dms, dvl, gol, mg, na |
PDB Entry: 6kuz (more details), 2.83 Å
SCOPe Domain Sequences for d6kuzb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kuzb4 b.1.4.0 (B:626-730) automated matches {Escherichia coli [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d6kuzb4:
View in 3D Domains from same chain: (mouse over for more information) d6kuzb1, d6kuzb2, d6kuzb3, d6kuzb5 |