Lineage for d6kuzb4 (6kuz B:626-730)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373157Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2373222Domain d6kuzb4: 6kuz B:626-730 [388909]
    Other proteins in same PDB: d6kuza1, d6kuza3, d6kuza5, d6kuzb1, d6kuzb3, d6kuzb5, d6kuzc1, d6kuzc3, d6kuzc5, d6kuzd1, d6kuzd3, d6kuzd5
    automated match to d1jz8a2
    complexed with dms, dvl, gol, mg, na

Details for d6kuzb4

PDB Entry: 6kuz (more details), 2.83 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksl01
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6kuzb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kuzb4 b.1.4.0 (B:626-730) automated matches {Escherichia coli [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d6kuzb4:

Click to download the PDB-style file with coordinates for d6kuzb4.
(The format of our PDB-style files is described here.)

Timeline for d6kuzb4: